PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn198731
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 312aa    MW: 35091.8 Da    PI: 7.2993
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn198731genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-1465107145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+++++E  l+++++   G++ W+ Ia++++ gRt++++k++w+
       Achn198731  65 RGSFSPQEAALIIELHSIIGNR-WAQIAKHLP-GRTDNEVKNFWN 107
                      899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.67E-2045116IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-54558IPR009057Homeodomain-like
PROSITE profilePS500904.0544659IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.1E-2559114IPR009057Homeodomain-like
PROSITE profilePS5129424.25460114IPR017930Myb domain
SMARTSM007171.1E-1464112IPR001005SANT/Myb domain
PfamPF002491.4E-1365108IPR001005SANT/Myb domain
CDDcd001671.42E-1067107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MISCCRIVIV YRNYHHMMRR IELKRERKRE RDGAPYMLRQ TEGLQRCGKS CRLRWINYLR  60
PDLKRGSFSP QEAALIIELH SIIGNRWAQI AKHLPGRTDN EVKNFWNSSI KKKLMISHDL  120
GHSDLPNFPN LSNIIGPFEG SFPLNLANPT FTPCPQEDQL FIPTPTQAFD HANPNFDANL  180
ISMPLGPPSY DSSWSNCMLN NTVIPCNTGD KMVTSNDPLV MPSYTMPSSS VSHEIGPITS  240
LSHFSSESCP YDPHVPTNQI EYINDIMSAL LPPSSSSSSS SMLLPWPNSQ FVGTCWSSYN  300
HFGCAHGDDF N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-234611440108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11828RRIELKRERKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5183192e-35AY518319.1 Gossypium hirsutum MYB7 gene, partial cds.
GenBankAY5183202e-35AY518320.1 Gossypium hirsutum MYB9 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002274626.13e-62PREDICTED: myb-related protein 305
TrEMBLF6HXY93e-62F6HXY9_VITVI; Putative uncharacterized protein
STRINGVIT_09s0002g01670.t018e-62(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1589635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.21e-46myb domain protein 26